PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK07646.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family WRKY
Protein Properties Length: 210aa    MW: 23963.4 Da    PI: 9.6188
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK07646.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32130188159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H h+
  PK07646.1 130 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGIVVTTYEGMHSHT 188
                59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-34115188IPR003657WRKY domain
SuperFamilySSF1182902.75E-29122189IPR003657WRKY domain
PROSITE profilePS5081129.528125190IPR003657WRKY domain
SMARTSM007744.7E-38130189IPR003657WRKY domain
PfamPF031064.1E-26131187IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MENNYLSKFL PFPTNSSSPS SSSSLSLSTA VDINLHNNSN NQAGYNNIKS SSSNDDNNNI  60
GFLGLMSEME IPATSNNDHH DQFQIQSSNN INAHHGQVMK LEKRKGDQNS NKKARKPRYA  120
FQTRSQVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CNVKKQVQRL TKDEGIVVTT  180
YEGMHSHTID KSTDNFEHIL SQMQIYTTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-28120189776Probable WRKY transcription factor 4
1wj2_A1e-28120189776Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR7515571e-163FR751557.1 Humulus lupulus mRNA for WRKY transcription factor (wrky1 gene), cultivar Osvald's 72, clone 3326.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222197.14e-76PREDICTED: probable WRKY transcription factor 75
TrEMBLG7ZLA66e-89G7ZLA6_HUMLU; WRKY transcription factor
STRINGPOPTR_0003s16750.12e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.15e-57WRKY DNA-binding protein 75